Lineage for d4p57a2 (4p57 A:84-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757341Domain d4p57a2: 4p57 A:84-179 [307979]
    Other proteins in same PDB: d4p57a1, d4p57c1
    automated match to d1muja1
    complexed with ca, gol, nag

Details for d4p57a2

PDB Entry: 4p57 (more details), 2.6 Å

PDB Description: mhc tcr peptide complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p57a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p57a2 b.1.1.0 (A:84-179) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy
sfhkfhyltfvpsaedfydcrvehwgldqpllkhwe

SCOPe Domain Coordinates for d4p57a2:

Click to download the PDB-style file with coordinates for d4p57a2.
(The format of our PDB-style files is described here.)

Timeline for d4p57a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p57a1