SCOPe 2.08: Domain d4p57a2: 4p57 A:84-179

Lineage for d4p57a2 (4p57 A:84-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4p57a2: 4p57 A:84-179 [307979]
   Other proteins in same PDB: d4p57a1, d4p57c1
   automated match to d1muja1
   complexed with ca, gol, nag

Details for d4p57a2

PDB Entry: 4p57, 2.6 Å

PDB Description: mhc tcr peptide complex

PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p57a2:

Sequence; same for both SEQRES and ATOM records:

>d4p57a2 b.1.1.0 (A:84-179) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy
sfhkfhyltfvpsaedfydcrvehwgldqpllkhwe

Timeline for d4p57a2:

• d4p57a2 first appeared in SCOPe 2.06
  
• d4p57a2 appears in SCOPe 2.07