Lineage for d4p4ra1 (4p4r A:2-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938863Domain d4p4ra1: 4p4r A:2-83 [307974]
    Other proteins in same PDB: d4p4ra2, d4p4rc2
    automated match to d1muja2
    complexed with nag

Details for d4p4ra1

PDB Entry: 4p4r (more details), 3 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4ra1 d.19.1.0 (A:2-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
niailnnnlntliqrsnhtqat

SCOPe Domain Coordinates for d4p4ra1:

Click to download the PDB-style file with coordinates for d4p4ra1.
(The format of our PDB-style files is described here.)

Timeline for d4p4ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p4ra2