Lineage for d4p41a3 (4p41 A:8-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718531Protein Viral cyclin [47961] (3 species)
  7. 2718532Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)
  8. 2718541Domain d4p41a3: 4p41 A:8-148 [307971]
    Other proteins in same PDB: d4p41b_
    automated match to d1jowa1
    complexed with 24v

Details for d4p41a3

PDB Entry: 4p41 (more details), 2.9 Å

PDB Description: Crystal structure of a CDK6/Vcyclin complex with inhibitor bound
PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d4p41a3:

Sequence, based on SEQRES records: (download)

>d4p41a3 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf
tnlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records): (download)

>d4p41a3 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
elinqekdilealkwdte

SCOPe Domain Coordinates for d4p41a3:

Click to download the PDB-style file with coordinates for d4p41a3.
(The format of our PDB-style files is described here.)

Timeline for d4p41a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p41a4
View in 3D
Domains from other chains:
(mouse over for more information)
d4p41b_