Lineage for d1derj2 (1der J:191-366)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67680Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 67681Family c.8.5.1: GroEL [52030] (1 protein)
  6. 67682Protein GroEL [52031] (2 species)
  7. 67683Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 67710Domain d1derj2: 1der J:191-366 [30797]
    Other proteins in same PDB: d1dera1, d1dera3, d1derb1, d1derb3, d1derc1, d1derc3, d1derd1, d1derd3, d1dere1, d1dere3, d1derf1, d1derf3, d1derg1, d1derg3, d1derh1, d1derh3, d1deri1, d1deri3, d1derj1, d1derj3, d1derk1, d1derk3, d1derl1, d1derl3, d1derm1, d1derm3, d1dern1, d1dern3

Details for d1derj2

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1derj2 c.8.5.1 (J:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1derj2:

Click to download the PDB-style file with coordinates for d1derj2.
(The format of our PDB-style files is described here.)

Timeline for d1derj2: