Lineage for d4p16a2 (4p16 A:62-319)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534714Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2534715Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2534716Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (5 PDB entries)
  8. 2534718Domain d4p16a2: 4p16 A:62-319 [307968]
    Other proteins in same PDB: d4p16a1
    complexed with zn

Details for d4p16a2

PDB Entry: 4p16 (more details), 2.5 Å

PDB Description: crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d4p16a2:

Sequence, based on SEQRES records: (download)

>d4p16a2 d.3.1.23 (A:62-319) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyss

Sequence, based on observed residues (ATOM records): (download)

>d4p16a2 d.3.1.23 (A:62-319) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgvghyvharlkgglilkfdsgtvsktsdwkc
kvtdvlfpgqkyss

SCOPe Domain Coordinates for d4p16a2:

Click to download the PDB-style file with coordinates for d4p16a2.
(The format of our PDB-style files is described here.)

Timeline for d4p16a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p16a1