![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein) N-terminal part of Pfam PF08715 |
![]() | Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species) |
![]() | Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311053] (1 PDB entry) |
![]() | Domain d4p16a1: 4p16 A:1-61 [307967] Other proteins in same PDB: d4p16a2 complexed with zn |
PDB Entry: 4p16 (more details), 2.5 Å
SCOPe Domain Sequences for d4p16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p16a1 d.15.1.9 (A:1-61) Papain-like protease PLpro, ubiquitin-like domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]} qltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnl t
Timeline for d4p16a1: