Lineage for d4ow0a2 (4ow0 A:63-315)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534714Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2534738Protein automated matches [310868] (6 species)
    not a true protein
  7. 2534755Species Sars coronavirus [TaxId:228330] [311412] (2 PDB entries)
  8. 2534756Domain d4ow0a2: 4ow0 A:63-315 [307964]
    Other proteins in same PDB: d4ow0a1
    automated match to d2fe8a2
    complexed with dms, gol, s88, zn

Details for d4ow0a2

PDB Entry: 4ow0 (more details), 2.1 Å

PDB Description: x-ray structural and biological evaluation of a series of potent and highly selective inhibitors of human coronavirus papain-like proteases
PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4ow0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ow0a2 d.3.1.23 (A:63-315) automated matches {Sars coronavirus [TaxId: 228330]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

SCOPe Domain Coordinates for d4ow0a2:

Click to download the PDB-style file with coordinates for d4ow0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ow0a2: