SCOPe 2.08: Domain d4ow0a2: 4ow0 A:63-315

Lineage for d4ow0a2 (4ow0 A:63-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Sars coronavirus [TaxId:228330] [311412] (2 PDB entries)

8. Domain d4ow0a2: 4ow0 A:63-315 [307964]
   Other proteins in same PDB: d4ow0a1
   automated match to d2fe8a2
   complexed with dms, gol, s88, zn

Details for d4ow0a2

PDB Entry: 4ow0, 2.1 Å

PDB Description: x-ray structural and biological evaluation of a series of potent and highly selective inhibitors of human coronavirus papain-like proteases

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4ow0a2:

Sequence; same for both SEQRES and ATOM records:

>d4ow0a2 d.3.1.23 (A:63-315) automated matches {Sars coronavirus [TaxId: 228330]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

Timeline for d4ow0a2:

• d4ow0a2 first appeared in SCOPe 2.06
  
• d4ow0a2 appears in SCOPe 2.07