Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Sars coronavirus [TaxId:228330] [311411] (2 PDB entries) |
Domain d4ow0a1: 4ow0 A:4-62 [307963] Other proteins in same PDB: d4ow0a2 automated match to d2fe8a1 complexed with dms, gol, s88, zn |
PDB Entry: 4ow0 (more details), 2.1 Å
SCOPe Domain Sequences for d4ow0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ow0a1 d.15.1.0 (A:4-62) automated matches {Sars coronavirus [TaxId: 228330]} ktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlpsd
Timeline for d4ow0a1: