SCOPe 2.06: Domain d4ow0a1: 4ow0 A:4-62

Lineage for d4ow0a1 (4ow0 A:4-62)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Sars coronavirus [TaxId:228330] [311411] (2 PDB entries)

8. Domain d4ow0a1: 4ow0 A:4-62 [307963]
   Other proteins in same PDB: d4ow0a2
   automated match to d2fe8a1
   complexed with dms, gol, s88, zn

Details for d4ow0a1

PDB Entry: 4ow0, 2.1 Å

PDB Description: x-ray structural and biological evaluation of a series of potent and highly selective inhibitors of human coronavirus papain-like proteases

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4ow0a1:

Sequence; same for both SEQRES and ATOM records:

>d4ow0a1 d.15.1.0 (A:4-62) automated matches {Sars coronavirus [TaxId: 228330]}
ktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlpsd

Timeline for d4ow0a1:

• d4ow0a1 is new in SCOPe 2.06-stable
  
• d4ow0a1 appears in SCOPe 2.07
  
• d4ow0a1 appears in the current release, SCOPe 2.08