Lineage for d4ow0a1 (4ow0 A:4-62)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933517Species Sars coronavirus [TaxId:228330] [311411] (2 PDB entries)
  8. 2933518Domain d4ow0a1: 4ow0 A:4-62 [307963]
    Other proteins in same PDB: d4ow0a2
    automated match to d2fe8a1
    complexed with dms, gol, s88, zn

Details for d4ow0a1

PDB Entry: 4ow0 (more details), 2.1 Å

PDB Description: x-ray structural and biological evaluation of a series of potent and highly selective inhibitors of human coronavirus papain-like proteases
PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4ow0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ow0a1 d.15.1.0 (A:4-62) automated matches {Sars coronavirus [TaxId: 228330]}
ktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlpsd

SCOPe Domain Coordinates for d4ow0a1:

Click to download the PDB-style file with coordinates for d4ow0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ow0a1: