Lineage for d4ou9b_ (4ou9 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066534Protein RPE65 [310786] (2 species)
  7. 2066546Species Synechocystis sp. [TaxId:1143] [311042] (4 PDB entries)
  8. 2066548Domain d4ou9b_: 4ou9 B: [307958]
    automated match to d2biwa_
    complexed with cl, fe2

Details for d4ou9b_

PDB Entry: 4ou9 (more details), 2 Å

PDB Description: Crystal structure of apocarotenoid oxygenase in the presence of Triton X-100
PDB Compounds: (B:) Apocarotenoid-15,15'-oxygenase

SCOPe Domain Sequences for d4ou9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ou9b_ b.69.15.1 (B:) RPE65 {Synechocystis sp. [TaxId: 1143]}
psqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpf
dgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlr
lkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpa
stfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaif
lqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanaf
eengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrcc
efpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepif
vprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaq
t

SCOPe Domain Coordinates for d4ou9b_:

Click to download the PDB-style file with coordinates for d4ou9b_.
(The format of our PDB-style files is described here.)

Timeline for d4ou9b_:

  • d4ou9b_ is new in SCOPe 2.06-stable