Lineage for d4ot7a_ (4ot7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080651Species Zymomonas mobilis [TaxId:264203] [311410] (1 PDB entry)
  8. 2080652Domain d4ot7a_: 4ot7 A: [307947]
    automated match to d3gkab_
    complexed with cl, fmn

Details for d4ot7a_

PDB Entry: 4ot7 (more details), 1.8 Å

PDB Description: x-structure of a variant of ncr from zymomonas mobilis
PDB Compounds: (A:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d4ot7a_:

Sequence, based on SEQRES records: (download)

>d4ot7a_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]}
mpslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgis
qeglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvpsnvsgmqpvapsa
sqapglghtydgkkpydvaralrldeiprllddyekaarhalkagfdgvqihaangylid
efirdstnhrhdeyggavenrirllkdvterviatigkertavrlspygvfnsmsggaet
givqvfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpplvlnqdytf
etaqaaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpkgytdypll

Sequence, based on observed residues (ATOM records): (download)

>d4ot7a_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]}
mpslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgis
qeglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvalrldeiprllddy
ekaarhalkagfdgvqihaangylidefieyggavenrirllkdvterviatigkertav
rlspygvfngivqvfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpp
lvlnqdytfetaqaaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpk
gytdypll

SCOPe Domain Coordinates for d4ot7a_:

Click to download the PDB-style file with coordinates for d4ot7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ot7a_:

  • d4ot7a_ is new in SCOPe 2.06-stable