![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
![]() | Protein automated matches [190048] (31 species) not a true protein |
![]() | Species Zymomonas mobilis [TaxId:264203] [311410] (1 PDB entry) |
![]() | Domain d4ot7a_: 4ot7 A: [307947] automated match to d3gkab_ complexed with cl, fmn |
PDB Entry: 4ot7 (more details), 1.8 Å
SCOPe Domain Sequences for d4ot7a_:
Sequence, based on SEQRES records: (download)
>d4ot7a_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]} mpslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgis qeglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvpsnvsgmqpvapsa sqapglghtydgkkpydvaralrldeiprllddyekaarhalkagfdgvqihaangylid efirdstnhrhdeyggavenrirllkdvterviatigkertavrlspygvfnsmsggaet givqvfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpplvlnqdytf etaqaaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpkgytdypll
>d4ot7a_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]} mpslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgis qeglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvalrldeiprllddy ekaarhalkagfdgvqihaangylidefieyggavenrirllkdvterviatigkertav rlspygvfngivqvfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpp lvlnqdytfetaqaaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpk gytdypll
Timeline for d4ot7a_: