Lineage for d4orex_ (4ore X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140118Species Haemophilus influenzae [TaxId:71421] [276702] (2 PDB entries)
  8. 2140120Domain d4orex_: 4ore X: [307946]
    automated match to d4lmab_
    complexed with oas

Details for d4orex_

PDB Entry: 4ore (more details), 2.2 Å

PDB Description: Cyrstal structure of O-acetylserine sulfhydrylase ternary complex from Haemophilus influenzae at 2.2 A
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d4orex_:

Sequence, based on SEQRES records: (download)

>d4orex_ c.79.1.0 (X:) automated matches {Haemophilus influenzae [TaxId: 71421]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalf

Sequence, based on observed residues (ATOM records): (download)

>d4orex_ c.79.1.0 (X:) automated matches {Haemophilus influenzae [TaxId: 71421]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatgntgialayvaaargykitltmpetmslerkrllcglgvnlvlteakgmkga
iakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggsit
gisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldlsii
drvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsase
rylstalf

SCOPe Domain Coordinates for d4orex_:

Click to download the PDB-style file with coordinates for d4orex_.
(The format of our PDB-style files is described here.)

Timeline for d4orex_:

  • d4orex_ is new in SCOPe 2.06-stable