Lineage for d4ordd1 (4ord D:3-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2944051Species Zebrafish (Danio rerio) [TaxId:7955] [311409] (1 PDB entry)
  8. 2944055Domain d4ordd1: 4ord D:3-139 [307944]
    Other proteins in same PDB: d4orda2, d4ordb2, d4ordc2, d4ordd2
    automated match to d2cy9b_

Details for d4ordd1

PDB Entry: 4ord (more details), 1.8 Å

PDB Description: Crystal Structure of Zebra Fish Thioesterase Superfamily Member 2
PDB Compounds: (D:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d4ordd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ordd1 d.38.1.5 (D:3-139) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
sltlntvkqiframadspgfdrvlskvevlsaapgkvvcemkveeqhtnrggtlhggmta
tlvdmistmaimysergapgvsvdmnitymnaakigedilitaqvlkqgrtlafatvdlt
nkangkliaqgrhtkhl

SCOPe Domain Coordinates for d4ordd1:

Click to download the PDB-style file with coordinates for d4ordd1.
(The format of our PDB-style files is described here.)

Timeline for d4ordd1: