SCOPe 2.08: Domain d4opnb_: 4opn B:

Lineage for d4opnb_ (4opn B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188562] (7 PDB entries)

8. Domain d4opnb_: 4opn B: [307937]
   automated match to d1qipb_
   complexed with zbf, zn

Details for d4opnb_

PDB Entry: 4opn, 2.1 Å

PDB Description: Crystal structure of mouse glyoxalase I complexed with mAH

PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d4opnb_:

Sequence; same for both SEQRES and ATOM records:

>d4opnb_ d.32.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sgltdetafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldfpamkf
slyflayedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkiat

Timeline for d4opnb_:

• d4opnb_ first appeared in SCOPe 2.06
  
• d4opnb_ appears in SCOPe 2.07