Lineage for d4omze_ (4omz E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308430Species Sinorhizobium fredii [TaxId:380] [311408] (2 PDB entries)
  8. 2308439Domain d4omze_: 4omz E: [307921]
    automated match to d3jthb_
    complexed with po4

Details for d4omze_

PDB Entry: 4omz (more details), 2.64 Å

PDB Description: Crystal Structure of NolR from Sinorhizobium fredii
PDB Compounds: (E:) NolR

SCOPe Domain Sequences for d4omze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omze_ a.4.5.0 (E:) automated matches {Sinorhizobium fredii [TaxId: 380]}
mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
klraqnlvstrrdaqtiyyssssdsvmkilgalseiyg

SCOPe Domain Coordinates for d4omze_:

Click to download the PDB-style file with coordinates for d4omze_.
(The format of our PDB-style files is described here.)

Timeline for d4omze_: