![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Sinorhizobium fredii [TaxId:380] [311408] (2 PDB entries) |
![]() | Domain d4omza_: 4omz A: [307917] automated match to d3jthb_ complexed with po4 |
PDB Entry: 4omz (more details), 2.64 Å
SCOPe Domain Sequences for d4omza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omza_ a.4.5.0 (A:) automated matches {Sinorhizobium fredii [TaxId: 380]} qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk lraqnlvstrrdaqtiyyssssdsvmkilgalseiyga
Timeline for d4omza_: