SCOPe 2.07: Domain d4omea3: 4ome A:594-750

Lineage for d4omea3 (4ome A:594-750)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family)
   automatically mapped to Pfam PF04253

5. Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)

6. Protein Glutamate carboxypeptidase II [140574] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140575] (27 PDB entries)
   Uniprot Q04609 594-750

8. Domain d4omea3: 4ome A:594-750 [307912]
   Other proteins in same PDB: d4omea1, d4omea2
   automated match to d2c6ca1
   complexed with ca, cl, dgq, nag, zn

Details for d4omea3

PDB Entry: 4ome, 1.79 Å

PDB Description: X-ray structure of human glutamate carboxypeptidase II in complex with DCCBL, a urea based inhibitor with distal carborane moiety

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4omea3:

Sequence, based on SEQRES records:

>d4omea3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records):

>d4omea3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

Timeline for d4omea3:

• d4omea3 first appeared in SCOPe 2.06