Lineage for d4olba1 (4olb A:22-412)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047719Family b.34.14.1: PAZ domain [101691] (6 protein domains)
  6. 2047723Protein Argonaute 2 [101692] (2 species)
    Pfam PF16486; Pfam PF08699; Pfam PF16488
  7. 2047731Species Human (Homo sapiens) [TaxId:9606] [310963] (4 PDB entries)
  8. 2047735Domain d4olba1: 4olb A:22-412 [307906]
    Other proteins in same PDB: d4olba2, d4olba3
    automated match to d4olaa1
    protein/RNA complex; complexed with trp

Details for d4olba1

PDB Entry: 4olb (more details), 2.9 Å

PDB Description: Crystal Structure of Human Argonaute2 Bound to Tryptophan
PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d4olba1:

Sequence, based on SEQRES records: (download)

>d4olba1 b.34.14.1 (A:22-412) Argonaute 2 {Human (Homo sapiens) [TaxId: 9606]}
afkppprpdfgtsgrtiklqanffemdipkidiyhyeldikpekcprrvnreivehmvqh
fktqifgdrkpvfdgrknlytamplpigrdkvelevtlpgegkdrifkvsikwvscvslq
alhdalsgrlpsvpfetiqaldvvmrhlpsmrytpvgrsfftasegcsnplgggrevwfg
fhqsvrpslwkmmlnidvsatafykaqpviefvcevldfksieeqqkpltdsqrvkftke
ikglkveithcgqmkrkyrvcnvtrrpashqtfplqqesgqtvectvaqyfkdrhklvlr
yphlpclqvgqeqkhtylplevcnivagqrcikkltdnqtstmiratarsapdrqeeisk
lmrsadfntdpyvrefgimvkdemtdvtgrv

Sequence, based on observed residues (ATOM records): (download)

>d4olba1 b.34.14.1 (A:22-412) Argonaute 2 {Human (Homo sapiens) [TaxId: 9606]}
afkppprpdfgtsgrtiklqanffemdipkidiyhyeldikpekcprrvnreivehmvqh
fktqifgdrkpvfdgrknlytamplpigrdkvelevtlrifkvsikwvscvslqalhdal
sgrlvpfetiqaldvvmrhlpsmrytpvgrsfftassnplgggrevwfgfhqsvrpslwk
mmlnidvsatafykaqpviefvcevldfksieqkpltdsqrvkftkeikglkveithkrk
yrvcnvtrrpashqtfplqqesgqtvectvaqyfkdrhklvlryphlpclqvgqehtylp
levcnivagqrcikkltdnqtstmiratarsapdrqeeisklmrsadfntdpyvrefgim
vkdemtdvtgrv

SCOPe Domain Coordinates for d4olba1:

Click to download the PDB-style file with coordinates for d4olba1.
(The format of our PDB-style files is described here.)

Timeline for d4olba1:

  • d4olba1 is new in SCOPe 2.06-stable