Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.15: PIWI domain C-terminal [310608] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1) |
Protein Argonaute-2 [310719] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [310965] (4 PDB entries) |
Domain d4olaa3: 4ola A:578-859 [307905] Other proteins in same PDB: d4olaa1, d4olaa2 protein/RNA complex; complexed with ipa, iph |
PDB Entry: 4ola (more details), 2.3 Å
SCOPe Domain Sequences for d4olaa3:
Sequence, based on SEQRES records: (download)
>d4olaa3 c.55.3.15 (A:578-859) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]} llpqgrppvfqqpviflgadvthppagdgkkpsiaavvgsmdahpnrycatvrvqqhrqe iiqdlaamvrelliqfykstrfkptriifyrdgvsegqfqqvlhhellaireaciklekd yqpgitfivvqkrhhtrlfctdknervgksgnipagttvdtkithptefdfylcshagiq gtsrpshyhvlwddnrfssdelqiltyqlchtyvrctrsvsipapayyahlvafraryhl vdkehdsaegshtsgqsngrdhqalakavqvhqdtlrtmyfa
>d4olaa3 c.55.3.15 (A:578-859) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]} llpqgrppvfqqpviflgadvthpkpsiaavvgsmdahpnrycatvrvqqhrqeiiqdla amvrelliqfykstrfkptriifyrdgvsegqfqqvlhhellaireaciklekdyqpgit fivvqkrhhtrlfctdknervgksgnipagttvdtkithptefdfylcshagiqgtsrps hyhvlwddnrfssdelqiltyqlchtyvrctrsvsipapayyahlvafraryhlhqalak avqvhqdtlrtmyfa
Timeline for d4olaa3: