Lineage for d4olaa3 (4ola A:578-859)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124854Family c.55.3.15: PIWI domain C-terminal [310608] (4 protein domains)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The N-terminal half is (c.44.3.1)
  6. 2124868Protein Argonaute-2 [310719] (1 species)
  7. 2124869Species Human (Homo sapiens) [TaxId:9606] [310965] (4 PDB entries)
  8. 2124870Domain d4olaa3: 4ola A:578-859 [307905]
    Other proteins in same PDB: d4olaa1, d4olaa2
    protein/RNA complex; complexed with ipa, iph

Details for d4olaa3

PDB Entry: 4ola (more details), 2.3 Å

PDB Description: Crystal Structure of Human Argonaute2
PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d4olaa3:

Sequence, based on SEQRES records: (download)

>d4olaa3 c.55.3.15 (A:578-859) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]}
llpqgrppvfqqpviflgadvthppagdgkkpsiaavvgsmdahpnrycatvrvqqhrqe
iiqdlaamvrelliqfykstrfkptriifyrdgvsegqfqqvlhhellaireaciklekd
yqpgitfivvqkrhhtrlfctdknervgksgnipagttvdtkithptefdfylcshagiq
gtsrpshyhvlwddnrfssdelqiltyqlchtyvrctrsvsipapayyahlvafraryhl
vdkehdsaegshtsgqsngrdhqalakavqvhqdtlrtmyfa

Sequence, based on observed residues (ATOM records): (download)

>d4olaa3 c.55.3.15 (A:578-859) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]}
llpqgrppvfqqpviflgadvthpkpsiaavvgsmdahpnrycatvrvqqhrqeiiqdla
amvrelliqfykstrfkptriifyrdgvsegqfqqvlhhellaireaciklekdyqpgit
fivvqkrhhtrlfctdknervgksgnipagttvdtkithptefdfylcshagiqgtsrps
hyhvlwddnrfssdelqiltyqlchtyvrctrsvsipapayyahlvafraryhlhqalak
avqvhqdtlrtmyfa

SCOPe Domain Coordinates for d4olaa3:

Click to download the PDB-style file with coordinates for d4olaa3.
(The format of our PDB-style files is described here.)

Timeline for d4olaa3:

  • d4olaa3 is new in SCOPe 2.06-stable