Lineage for d1derb2 (1der B:191-366)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240180Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 240287Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 240288Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 240289Protein GroEL, A domain [52031] (3 species)
  7. 240290Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 240310Domain d1derb2: 1der B:191-366 [30789]
    Other proteins in same PDB: d1dera1, d1dera3, d1derb1, d1derb3, d1derc1, d1derc3, d1derd1, d1derd3, d1dere1, d1dere3, d1derf1, d1derf3, d1derg1, d1derg3, d1derh1, d1derh3, d1deri1, d1deri3, d1derj1, d1derj3, d1derk1, d1derk3, d1derl1, d1derl3, d1derm1, d1derm3, d1dern1, d1dern3

Details for d1derb2

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1derb2 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1derb2:

Click to download the PDB-style file with coordinates for d1derb2.
(The format of our PDB-style files is described here.)

Timeline for d1derb2: