Lineage for d1dera2 (1der A:191-366)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119667Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 119668Family c.8.5.1: GroEL [52030] (1 protein)
  6. 119669Protein GroEL [52031] (3 species)
  7. 119670Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 119688Domain d1dera2: 1der A:191-366 [30788]
    Other proteins in same PDB: d1dera1, d1dera3, d1derb1, d1derb3, d1derc1, d1derc3, d1derd1, d1derd3, d1dere1, d1dere3, d1derf1, d1derf3, d1derg1, d1derg3, d1derh1, d1derh3, d1deri1, d1deri3, d1derj1, d1derj3, d1derk1, d1derk3, d1derl1, d1derl3, d1derm1, d1derm3, d1dern1, d1dern3

Details for d1dera2

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1dera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dera2 c.8.5.1 (A:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1dera2:

Click to download the PDB-style file with coordinates for d1dera2.
(The format of our PDB-style files is described here.)

Timeline for d1dera2: