Lineage for d4ofwd2 (4ofw D:191-388)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118193Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2118194Protein automated matches [190197] (20 species)
    not a true protein
  7. 2118388Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries)
  8. 2118408Domain d4ofwd2: 4ofw D:191-388 [307868]
    Other proteins in same PDB: d4ofwa3, d4ofwb3, d4ofwc3, d4ofwd3, d4ofwe3, d4ofwf3
    automated match to d3uk7a2

Details for d4ofwd2

PDB Entry: 4ofw (more details), 2.3 Å

PDB Description: crystal structure of arabidopsis thaliana dj-1d
PDB Compounds: (D:) Protein DJ-1 homolog D

SCOPe Domain Sequences for d4ofwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofwd2 c.23.16.0 (D:191-388) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkitgankrilflcgdymedyevkvpfqslqalgcqvdavcpekkagercptaihdfegd
qtysekpghtfalttnfddlvsssydalvipggrapeylalnehvlnivkefmnsekpva
sichgqqilaaagvlkgrkctaypavklnvvlgggtwlepdpidrcftdgnlvtgaawpg
hpefvsqlmallgiqvsf

SCOPe Domain Coordinates for d4ofwd2:

Click to download the PDB-style file with coordinates for d4ofwd2.
(The format of our PDB-style files is described here.)

Timeline for d4ofwd2: