Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein GroEL, A domain [52031] (4 species) |
Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
Domain d1oelf2: 1oel F:191-366 [30786] Other proteins in same PDB: d1oela1, d1oela3, d1oelb1, d1oelb3, d1oelc4, d1oelc5, d1oeld1, d1oeld3, d1oele1, d1oele3, d1oelf1, d1oelf3, d1oelg1, d1oelg3 |
PDB Entry: 1oel (more details), 2.8 Å
SCOPe Domain Sequences for d1oelf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oelf2 c.8.5.1 (F:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1oelf2: