| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (23 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries) |
| Domain d4ofwa2: 4ofw A:191-388 [307859] Other proteins in same PDB: d4ofwa3, d4ofwb3, d4ofwc3, d4ofwd3, d4ofwe3, d4ofwf3 automated match to d3uk7a2 |
PDB Entry: 4ofw (more details), 2.3 Å
SCOPe Domain Sequences for d4ofwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ofwa2 c.23.16.0 (A:191-388) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkitgankrilflcgdymedyevkvpfqslqalgcqvdavcpekkagercptaihdfegd
qtysekpghtfalttnfddlvsssydalvipggrapeylalnehvlnivkefmnsekpva
sichgqqilaaagvlkgrkctaypavklnvvlgggtwlepdpidrcftdgnlvtgaawpg
hpefvsqlmallgiqvsf
Timeline for d4ofwa2: