![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
![]() | Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) ![]() |
![]() | Family c.8.5.1: GroEL [52030] (1 protein) |
![]() | Protein GroEL [52031] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52032] (10 PDB entries) |
![]() | Domain d1oeld2: 1oel D:191-366 [30784] Other proteins in same PDB: d1oela1, d1oela3, d1oelb1, d1oelb3, d1oelc4, d1oelc5, d1oeld1, d1oeld3, d1oele1, d1oele3, d1oelf1, d1oelf3, d1oelg1, d1oelg3 |
PDB Entry: 1oel (more details), 2.8 Å
SCOP Domain Sequences for d1oeld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oeld2 c.8.5.1 (D:191-366) GroEL {Escherichia coli} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1oeld2: