SCOPe 2.06: Domain d4o4xb3: 4o4x B:300-390

Lineage for d4o4xb3 (4o4x B:300-390)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
   2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin

4. Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families)
   C-terminal part of Pfam PF01298

5. Family b.181.1.0: automated matches [310674] (1 protein)
   not a true family

6. Protein automated matches [310874] (3 species)
   not a true protein

7. Species Haemophilus parasuis [TaxId:738] [311403] (2 PDB entries)

8. Domain d4o4xb3: 4o4x B:300-390 [307838]
   Other proteins in same PDB: d4o4xa2, d4o4xa4, d4o4xb2, d4o4xb4
   automated match to d3hola4
   complexed with gol, na, so4; mutant

Details for d4o4xb3

PDB Entry: 4o4x, 2.9 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5

PDB Compounds: (B:) TbpB

SCOPe Domain Sequences for d4o4xb3:

Sequence, based on SEQRES records:

>d4o4xb3 b.181.1.0 (B:300-390) automated matches {Haemophilus parasuis [TaxId: 738]}
idaskidltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsn
leymkfgqlwqqtegekqvkdnslflqgert

Sequence, based on observed residues (ATOM records):

>d4o4xb3 b.181.1.0 (B:300-390) automated matches {Haemophilus parasuis [TaxId: 738]}
idaskidltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsn
leymkfgqlwqqtqvkdnslflqgert

Timeline for d4o4xb3:

• d4o4xb3 is new in SCOPe 2.06-stable
  
• d4o4xb3 appears in SCOPe 2.07
  
• d4o4xb3 appears in the current release, SCOPe 2.08