Lineage for d4o4xa2 (4o4x A:136-299)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251384Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2251452Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2251453Protein automated matches [191257] (5 species)
    not a true protein
  7. 2251463Species Haemophilus parasuis [TaxId:738] [311404] (2 PDB entries)
  8. 2251472Domain d4o4xa2: 4o4x A:136-299 [307833]
    Other proteins in same PDB: d4o4xa1, d4o4xa3, d4o4xb1, d4o4xb3
    automated match to d3hola1
    complexed with gol, na, so4; mutant

Details for d4o4xa2

PDB Entry: 4o4x (more details), 2.9 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5
PDB Compounds: (A:) TbpB

SCOPe Domain Sequences for d4o4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4xa2 f.4.1.0 (A:136-299) automated matches {Haemophilus parasuis [TaxId: 738]}
kelpqgpaltyqgewdftsdanlnneegrptalnddyyttaigkraglvsgdakpskhky
tsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvds
qsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvri

SCOPe Domain Coordinates for d4o4xa2:

Click to download the PDB-style file with coordinates for d4o4xa2.
(The format of our PDB-style files is described here.)

Timeline for d4o4xa2: