Lineage for d4o4ud4 (4o4u D:391-537)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3022041Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 3022042Protein automated matches [191257] (6 species)
    not a true protein
  7. 3022054Species Haemophilus parasuis [TaxId:738] [311404] (2 PDB entries)
  8. 3022062Domain d4o4ud4: 4o4u D:391-537 [307831]
    Other proteins in same PDB: d4o4ua1, d4o4ua3, d4o4ub1, d4o4ub3, d4o4uc1, d4o4uc3, d4o4ud1, d4o4ud3
    automated match to d3hola2
    complexed with gol; mutant

Details for d4o4ud4

PDB Entry: 4o4u (more details), 2.64 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
PDB Compounds: (D:) TbpB

SCOPe Domain Sequences for d4o4ud4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4ud4 f.4.1.0 (D:391-537) automated matches {Haemophilus parasuis [TaxId: 738]}
atdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdk
ngvnpvftvnakidgngftgeaktsdagfvldpgslrhdnvkfsdvavsggfygptaael
ggqfryqsdngsvgvgavfgakqqvkk

SCOPe Domain Coordinates for d4o4ud4:

Click to download the PDB-style file with coordinates for d4o4ud4.
(The format of our PDB-style files is described here.)

Timeline for d4o4ud4: