Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.0: automated matches [191664] (1 protein) not a true family |
Protein automated matches [191257] (6 species) not a true protein |
Species Haemophilus parasuis [TaxId:738] [311404] (2 PDB entries) |
Domain d4o4ud4: 4o4u D:391-537 [307831] Other proteins in same PDB: d4o4ua1, d4o4ua3, d4o4ub1, d4o4ub3, d4o4uc1, d4o4uc3, d4o4ud1, d4o4ud3 automated match to d3hola2 complexed with gol; mutant |
PDB Entry: 4o4u (more details), 2.64 Å
SCOPe Domain Sequences for d4o4ud4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4ud4 f.4.1.0 (D:391-537) automated matches {Haemophilus parasuis [TaxId: 738]} atdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdk ngvnpvftvnakidgngftgeaktsdagfvldpgslrhdnvkfsdvavsggfygptaael ggqfryqsdngsvgvgavfgakqqvkk
Timeline for d4o4ud4: