Lineage for d4o4ud1 (4o4u D:25-135)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2413175Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2413176Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2413185Family b.181.1.0: automated matches [310674] (1 protein)
    not a true family
  6. 2413186Protein automated matches [310874] (3 species)
    not a true protein
  7. 2413196Species Haemophilus parasuis [TaxId:738] [311403] (2 PDB entries)
  8. 2413203Domain d4o4ud1: 4o4u D:25-135 [307828]
    Other proteins in same PDB: d4o4ua2, d4o4ua4, d4o4ub2, d4o4ub4, d4o4uc2, d4o4uc4, d4o4ud2, d4o4ud4
    automated match to d3hola3
    complexed with gol; mutant

Details for d4o4ud1

PDB Entry: 4o4u (more details), 2.64 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
PDB Compounds: (D:) TbpB

SCOPe Domain Sequences for d4o4ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4ud1 b.181.1.0 (D:25-135) automated matches {Haemophilus parasuis [TaxId: 738]}
eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitps

SCOPe Domain Coordinates for d4o4ud1:

Click to download the PDB-style file with coordinates for d4o4ud1.
(The format of our PDB-style files is described here.)

Timeline for d4o4ud1: