Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.0: automated matches [191664] (1 protein) not a true family |
Protein automated matches [191257] (6 species) not a true protein |
Species Actinobacillus pleuropneumoniae [TaxId:715] [311328] (4 PDB entries) |
Domain d4o3za4: 4o3z A:385-528 [307811] Other proteins in same PDB: d4o3za1, d4o3za3 automated match to d3hola2 complexed with act, gol; mutant |
PDB Entry: 4o3z (more details), 2.9 Å
SCOPe Domain Sequences for d4o3za4:
Sequence, based on SEQRES records: (download)
>d4o3za4 f.4.1.0 (A:385-528) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]} atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg givpvfminadikgngftgtanttdtgfaldsgssqhgnavfsdikvnggfygptagelg gqfhhksdngsvgavfgakrqiek
>d4o3za4 f.4.1.0 (A:385-528) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]} atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg givpvfminadikgngftgtanttdtgfaldsqhgnavfsdikvnggfygptagelggqf hhksdngsvgavfgakrqiek
Timeline for d4o3za4: