Lineage for d4o3za2 (4o3z A:138-295)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3022041Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 3022042Protein automated matches [191257] (6 species)
    not a true protein
  7. 3022043Species Actinobacillus pleuropneumoniae [TaxId:715] [311328] (4 PDB entries)
  8. 3022050Domain d4o3za2: 4o3z A:138-295 [307809]
    Other proteins in same PDB: d4o3za1, d4o3za3
    automated match to d3hola1
    complexed with act, gol; mutant

Details for d4o3za2

PDB Entry: 4o3z (more details), 2.9 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant tyr-95-ala from actinobacillus pleuropneumoniae h87
PDB Compounds: (A:) Outer membrane protein; transferrin-binding protein

SCOPe Domain Sequences for d4o3za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o3za2 f.4.1.0 (A:138-295) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]}
kelpkgniivyqgewdftsnadldakrpnynpefngygagqrvgvtsadakertyiskfn
idfsnkklngqlltktkenqeklrytveanisgnrfrgkatatdktdpilgkdsehlegg
lygpkseelagkfvahdkslfavfsgkrgndvletvki

SCOPe Domain Coordinates for d4o3za2:

Click to download the PDB-style file with coordinates for d4o3za2.
(The format of our PDB-style files is described here.)

Timeline for d4o3za2: