Lineage for d4o3xb1 (4o3x B:45-130)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078525Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2078526Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2078527Family b.181.1.1: Handle domain of Transferrin binding protein TbpB-like [310639] (1 protein)
  6. 2078528Protein Handle domain of Transferrin binding protein TbpB [310778] (1 species)
  7. 2078529Species Actinobacillus pleuropneumoniae [TaxId:715] [311034] (3 PDB entries)
  8. 2078534Domain d4o3xb1: 4o3x B:45-130 [307802]
    Other proteins in same PDB: d4o3xb2
    automated match to d3hoea2
    mutant

Details for d4o3xb1

PDB Entry: 4o3x (more details), 2.5 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
PDB Compounds: (B:) Transferrin binding protein B

SCOPe Domain Sequences for d4o3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o3xb1 b.181.1.1 (B:45-130) Handle domain of Transferrin binding protein TbpB {Actinobacillus pleuropneumoniae [TaxId: 715]}
palgyvvkvpvssfenkkvdisdievitngnlddvpykansskynypdiktkdsslqyvr
sgyvidgehsgsnekgyvyykgnspa

SCOPe Domain Coordinates for d4o3xb1:

Click to download the PDB-style file with coordinates for d4o3xb1.
(The format of our PDB-style files is described here.)

Timeline for d4o3xb1:

  • d4o3xb1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4o3xb2