SCOP 1.69: Domain d1jon__: 1jon -

Lineage for d1jon__ (1jon -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)

6. Protein GroEL, A domain [52031] (3 species)

7. Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

8. Domain d1jon__: 1jon - [30780]
   separately expressed fragment

Details for d1jon__

PDB Entry: 1jon, 2.5 Å

PDB Description: groel (hsp60 class) fragment comprising residues 191-345

SCOP Domain Sequences for d1jon__:

Sequence, based on SEQRES records:

>d1jon__ c.8.5.1 (-) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Sequence, based on observed residues (ATOM records):

>d1jon__ c.8.5.1 (-) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
dlgqakrvvinkdtttiidgv

Timeline for d1jon__:

• d1jon__ first appeared (with stable ids) in SCOP 1.55
  
• d1jon__ appears in SCOP 1.67
  
• d1jon__ appears in SCOP 1.71
  
• d1jon__ appears in the current release, SCOPe 2.08, called d1jona_