Lineage for d1jon__ (1jon -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389745Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 389746Protein GroEL, A domain [52031] (3 species)
  7. 389747Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 389766Domain d1jon__: 1jon - [30780]
    separately expressed fragment
    mutant

Details for d1jon__

PDB Entry: 1jon (more details), 2.5 Å

PDB Description: groel (hsp60 class) fragment comprising residues 191-345

SCOP Domain Sequences for d1jon__:

Sequence, based on SEQRES records: (download)

>d1jon__ c.8.5.1 (-) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Sequence, based on observed residues (ATOM records): (download)

>d1jon__ c.8.5.1 (-) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
dlgqakrvvinkdtttiidgv

SCOP Domain Coordinates for d1jon__:

Click to download the PDB-style file with coordinates for d1jon__.
(The format of our PDB-style files is described here.)

Timeline for d1jon__: