Lineage for d1jona_ (1jon A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2098069Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2098070Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 protein domains)
  6. 2098071Protein GroEL, A domain [52031] (4 species)
  7. 2098072Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 2098097Domain d1jona_: 1jon A: [30780]
    separately expressed fragment

Details for d1jona_

PDB Entry: 1jon (more details), 2.5 Å

PDB Description: groel (hsp60 class) fragment comprising residues 191-345
PDB Compounds: (A:) groEL, hsp60 class

SCOPe Domain Sequences for d1jona_:

Sequence, based on SEQRES records: (download)

>d1jona_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgv

Sequence, based on observed residues (ATOM records): (download)

>d1jona_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
dlgqakrvvinkdtttiidgv

SCOPe Domain Coordinates for d1jona_:

Click to download the PDB-style file with coordinates for d1jona_.
(The format of our PDB-style files is described here.)

Timeline for d1jona_: