Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
Domain d4nz8a2: 4nz8 A:283-544 [307797] Other proteins in same PDB: d4nz8a1, d4nz8a3, d4nz8a4, d4nz8a5 automated match to d4fyta2 complexed with nag, so4, zn |
PDB Entry: 4nz8 (more details), 2 Å
SCOPe Domain Sequences for d4nz8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nz8a2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d4nz8a2:
View in 3D Domains from same chain: (mouse over for more information) d4nz8a1, d4nz8a3, d4nz8a4, d4nz8a5 |