Lineage for d4nz8a2 (4nz8 A:283-544)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2965055Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries)
  8. 2965066Domain d4nz8a2: 4nz8 A:283-544 [307797]
    Other proteins in same PDB: d4nz8a1, d4nz8a3, d4nz8a4, d4nz8a5
    automated match to d4fyta2
    complexed with nag, so4, zn

Details for d4nz8a2

PDB Entry: 4nz8 (more details), 2 Å

PDB Description: crystal structure of porcine aminopeptidase-n complexed with cleaved poly-alanine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4nz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nz8a2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d4nz8a2:

Click to download the PDB-style file with coordinates for d4nz8a2.
(The format of our PDB-style files is described here.)

Timeline for d4nz8a2: