Lineage for d4nvrc_ (4nvr C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153475Species Salmonella enterica [TaxId:99287] [311402] (1 PDB entry)
  8. 2153478Domain d4nvrc_: 4nvr C: [307792]
    automated match to d4baua_
    complexed with ca, cl

Details for d4nvrc_

PDB Entry: 4nvr (more details), 2.22 Å

PDB Description: 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
PDB Compounds: (C:) Putative acyltransferase

SCOPe Domain Sequences for d4nvrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvrc_ c.69.1.0 (C:) automated matches {Salmonella enterica [TaxId: 99287]}
liecgaspfipgfalkdvrlengltvrvaiggsgsplvllhghpqnhttwrkvaptlaqn
htvilpdlrgygdsdkptsdpahrtyskrtmaqdivmlmdalgfsrfafvghdrggrvgh
rlaldypdrvtcctfidiaptatmyaltdksfatryfwwffliqpfplpetmiahdpaff
lrkhisgqlkiegatsqeafneylrcyqnpemihaicedyraaatidldddaadtsarir
cplqllwgglgtvgqlynvvgtwkekalnvqgealpcghspqeecpeyfiqklqsflhsv
l

SCOPe Domain Coordinates for d4nvrc_:

Click to download the PDB-style file with coordinates for d4nvrc_.
(The format of our PDB-style files is described here.)

Timeline for d4nvrc_: