Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein GroEL, A domain [52031] (4 species) |
Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
Domain d1fy9a_: 1fy9 A: [30779] complexed with gol; mutant |
PDB Entry: 1fy9 (more details), 2.2 Å
SCOPe Domain Sequences for d1fy9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fy9a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre klqervaklaggv
Timeline for d1fy9a_: