SCOPe 2.02: Domain d1fy9a_: 1fy9 A:

Lineage for d1fy9a_ (1fy9 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

8. Domain d1fy9a_: 1fy9 A: [30779]
   complexed with gol; mutant

Details for d1fy9a_

PDB Entry: 1fy9, 2.2 Å

PDB Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain

PDB Compounds: (A:) 60 kd chaperonin

SCOPe Domain Sequences for d1fy9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fy9a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

Timeline for d1fy9a_:

• d1fy9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fy9a_ appears in SCOPe 2.01
  
• d1fy9a_ appears in SCOPe 2.03
  
• d1fy9a_ appears in the current release, SCOPe 2.08, called d1fy9a1