Lineage for d1fy9a_ (1fy9 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 479858Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 479859Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 479860Protein GroEL, A domain [52031] (3 species)
  7. 479861Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 479879Domain d1fy9a_: 1fy9 A: [30779]

Details for d1fy9a_

PDB Entry: 1fy9 (more details), 2.2 Å

PDB Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain

SCOP Domain Sequences for d1fy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fy9a_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli}
glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOP Domain Coordinates for d1fy9a_:

Click to download the PDB-style file with coordinates for d1fy9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fy9a_: