| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein) |
| Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries) |
| Domain d4nr1a_: 4nr1 A: [307789] automated match to d3p3na_ protein/DNA complex; complexed with oga, so4, zn |
PDB Entry: 4nr1 (more details), 2.68 Å
SCOPe Domain Sequences for d4nr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nr1a_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
kvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d4nr1a_: