SCOPe 2.08: Domain d4nlaa1: 4nla A:183-303

Lineage for d4nlaa1 (4nla A:183-303)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [260500] (2 PDB entries)

8. Domain d4nlaa1: 4nla A:183-303 [307787]
   Other proteins in same PDB: d4nlaa2
   automated match to d4mypa_
   complexed with so4

Details for d4nlaa1

PDB Entry: 4nla, 2.7 Å

PDB Description: Structure of the central NEAT domain, N2, of the listerial Hbp2 protein, apo form

PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d4nlaa1:

Sequence; same for both SEQRES and ATOM records:

>d4nlaa1 b.1.28.0 (A:183-303) automated matches {Listeria monocytogenes [TaxId: 1639]}
tlsdgiytipfvakkanddsnssmqnyfnnpawlkvkngkkmvamtvndnktvtalkttl
agtlqdvkvvsedkdantrivefevedlnqplaahvnyeapfngsvykgqadfryvfdta
k

Timeline for d4nlaa1:

• d4nlaa1 first appeared in SCOPe 2.06
  
• d4nlaa1 appears in SCOPe 2.07