SCOPe 2.06: Domain d4nkqb_: 4nkq B:

Lineage for d4nkqb_ (4nkq B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries)

8. Domain d4nkqb_: 4nkq B: [307786]
   complexed with nag

Details for d4nkqb_

PDB Entry: 4nkq, 3.3 Å

PDB Description: structure of a cytokine receptor complex

PDB Compounds: (B:) Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

SCOPe Domain Sequences for d4nkqb_:

Sequence, based on SEQRES records:

>d4nkqb_ a.26.1.2 (B:) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaaqnfscfiynadlmnctwargptaprdvqyflyir
nskrrreircpyyiqdsgthvgchldnlsgltsrnyflvngtsreigiqffdslldtkki
erfnppsnvtvrcntthclvrwkqprtyqklsyldfqyqldvhrkntqpgtenllinvsg
dlenrynfpsseprakhsvkiraadvrilnwsswseaief

Sequence, based on observed residues (ATOM records):

>d4nkqb_ a.26.1.2 (B:) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
xxxxxxxxxxxxxxxxxnsgregtaqnfscfiynadlmnctwargptdvqyflircpyyi
qdsgthvgchldnlsgltsrnyfslldtkkierfnppsnvtvrcntthclvrwkqprtyq
klsyldfqyqldvhrkntqpgtenllinvsgdlenrynfpsseprakhsvkiraadvril
nwsswseaief

Timeline for d4nkqb_:

• d4nkqb_ is new in SCOPe 2.06-stable
  
• d4nkqb_ last appears in SCOPe 2.07