Lineage for d4nf7a1 (4nf7 A:34-394)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441141Species Butyrivibrio proteoclasticus [TaxId:515622] [311401] (1 PDB entry)
  8. 2441142Domain d4nf7a1: 4nf7 A:34-394 [307775]
    Other proteins in same PDB: d4nf7a2
    automated match to d4w88b_

Details for d4nf7a1

PDB Entry: 4nf7 (more details), 2.11 Å

PDB Description: crystal structure of the gh5 family catalytic domain of endo-1,4-beta- glucanase cel5c from butyrivibrio proteoclasticus.
PDB Compounds: (A:) Endo-1,4-beta-glucanase Cel5C

SCOPe Domain Sequences for d4nf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nf7a1 c.1.8.0 (A:34-394) automated matches {Butyrivibrio proteoclasticus [TaxId: 515622]}
gtdrsatqvvsdmrvgwnignsldsfgqsynfpytslnetywgnpattkalidevakagf
ntiripvswgqytsgsdyqipdfvmnrvkevvdycivndmyvilnshhdinsdycfyvpn
nankdrsekyfksiwtqiakefrnydyhlvfetmneprlvghgeewwfprnnpsndirea
vacindynqvaldairatggnnatrcvmvpgydasiegcmtdgfkmpndtasgrlilsvh
ayipyyfalasdtyvtrfddnlkydidsffndlnskflsrnipvvvgetsatnrnntaer
vkwadyywgraarysnvamvlwdnniyqnnsagsdgechmyidrnslqwkdpeiistimk
h

SCOPe Domain Coordinates for d4nf7a1:

Click to download the PDB-style file with coordinates for d4nf7a1.
(The format of our PDB-style files is described here.)

Timeline for d4nf7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nf7a2