Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries) |
Domain d4naqa4: 4naq A:634-963 [307773] Other proteins in same PDB: d4naqa1, d4naqa2, d4naqa3, d4naqa5 automated match to d4fyta4 complexed with nag, so4, zn |
PDB Entry: 4naq (more details), 2.1 Å
SCOPe Domain Sequences for d4naqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4naqa4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra leqalektkanikwvkenkevvlnwfiehs
Timeline for d4naqa4:
View in 3D Domains from same chain: (mouse over for more information) d4naqa1, d4naqa2, d4naqa3, d4naqa5 |