![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
![]() | Domain d4naqa2: 4naq A:283-544 [307771] Other proteins in same PDB: d4naqa1, d4naqa3, d4naqa4, d4naqa5 automated match to d4fyta2 complexed with nag, so4, zn |
PDB Entry: 4naq (more details), 2.1 Å
SCOPe Domain Sequences for d4naqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4naqa2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahqlahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d4naqa2:
![]() Domains from same chain: (mouse over for more information) d4naqa1, d4naqa3, d4naqa4, d4naqa5 |