Lineage for d4naqa1 (4naq A:64-282)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409030Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2409031Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2409115Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2409116Protein automated matches [254706] (5 species)
    not a true protein
  7. 2409156Species Pig (Sus scrofa) [TaxId:9823] [311377] (17 PDB entries)
  8. 2409164Domain d4naqa1: 4naq A:64-282 [307770]
    Other proteins in same PDB: d4naqa2, d4naqa3, d4naqa4, d4naqa5
    automated match to d4fyqa1
    complexed with nag, so4, zn

Details for d4naqa1

PDB Entry: 4naq (more details), 2.1 Å

PDB Description: Crystal structure of porcine aminopeptidase-N complexed with poly-alanine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4naqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4naqa1 b.98.1.0 (A:64-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl
nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
mppkgsstplaedpnwsvtefettpvmstyllayivsef

SCOPe Domain Coordinates for d4naqa1:

Click to download the PDB-style file with coordinates for d4naqa1.
(The format of our PDB-style files is described here.)

Timeline for d4naqa1: