Lineage for d4nacb1 (4nac B:2-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727132Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
    SMART 00582; Pfam PF04818
  6. 2727158Protein automated matches [190213] (2 species)
    not a true protein
  7. 2727161Species Human (Homo sapiens) [TaxId:9606] [311400] (1 PDB entry)
  8. 2727163Domain d4nacb1: 4nac B:2-131 [307768]
    Other proteins in same PDB: d4naca2, d4nacb2
    automated match to d4fu3a_

Details for d4nacb1

PDB Entry: 4nac (more details), 2 Å

PDB Description: crystal structure of the n-terminal domain of p15rs
PDB Compounds: (B:) Regulation of nuclear pre-mRNA domain-containing protein 1A

SCOPe Domain Sequences for d4nacb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nacb1 a.118.9.4 (B:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
safseaalekklselsnsqqsvqtlslwlihhrkhsrpivtvwerelrkakpnrkltfly
landviqnskrkgpeftkdfapviveafkhvssetdesckkhlgrvlsiweersvyendv
leqlkqalyg

SCOPe Domain Coordinates for d4nacb1:

Click to download the PDB-style file with coordinates for d4nacb1.
(The format of our PDB-style files is described here.)

Timeline for d4nacb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nacb2