SCOPe 2.07: Domain d4nacb1: 4nac B:2-131

Lineage for d4nacb1 (4nac B:2-131)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 protein domains)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
   SMART 00582; Pfam PF04818

6. Protein automated matches [190213] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311400] (1 PDB entry)

8. Domain d4nacb1: 4nac B:2-131 [307768]
   Other proteins in same PDB: d4naca2, d4nacb2
   automated match to d4fu3a_

Details for d4nacb1

PDB Entry: 4nac, 2 Å

PDB Description: crystal structure of the n-terminal domain of p15rs

PDB Compounds: (B:) Regulation of nuclear pre-mRNA domain-containing protein 1A

SCOPe Domain Sequences for d4nacb1:

Sequence; same for both SEQRES and ATOM records:

>d4nacb1 a.118.9.4 (B:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
safseaalekklselsnsqqsvqtlslwlihhrkhsrpivtvwerelrkakpnrkltfly
landviqnskrkgpeftkdfapviveafkhvssetdesckkhlgrvlsiweersvyendv
leqlkqalyg

Timeline for d4nacb1:

• d4nacb1 first appeared in SCOPe 2.06