![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
![]() | Protein automated matches [190213] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311400] (1 PDB entry) |
![]() | Domain d4nacb1: 4nac B:2-131 [307768] Other proteins in same PDB: d4naca2, d4nacb2 automated match to d4fu3a_ |
PDB Entry: 4nac (more details), 2 Å
SCOPe Domain Sequences for d4nacb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nacb1 a.118.9.4 (B:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]} safseaalekklselsnsqqsvqtlslwlihhrkhsrpivtvwerelrkakpnrkltfly landviqnskrkgpeftkdfapviveafkhvssetdesckkhlgrvlsiweersvyendv leqlkqalyg
Timeline for d4nacb1: